PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05799.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 235aa    MW: 26663 Da    PI: 6.1539
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05799.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1371.2e-4261372128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                              + GfrF Pt++elv +yL++++eg++  ++++vi+ +d+++veP++Lp+    +++++ ++w+fF++r++++a+g r++r+t sgy
  Rsa1.0_05799.1_g00002.1   6 TIGFRFYPTEDELVAFYLRNQLEGRSdDSMHRVIPVLDVFEVEPSHLPNvageRCRGDAEQWFFFVPRQEREARGGRPSRTTGSGY 91 
                              68***********************95555677***************646666666888************************** PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              Wkatg+  +v+sk+++ +g+kkt+vfy+g+ap+g+kt+W m+ey++
  Rsa1.0_05799.1_g00002.1  92 WKATGSPGPVISKDNRMIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 137
                              ********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-474162IPR003441NAC domain
PROSITE profilePS5100547.0535162IPR003441NAC domain
PfamPF023656.5E-237136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MAEELTIGFR FYPTEDELVA FYLRNQLEGR SDDSMHRVIP VLDVFEVEPS HLPNVAGERC  60
RGDAEQWFFF VPRQEREARG GRPSRTTGSG YWKATGSPGP VISKDNRMIG VKKTMVFYTG  120
KAPTGRKTKW KMNEYKAVDE TVNVSTIPKL RHEFSLCRVY ITSGSSRAFD RRPVGSFQTE  180
RMLTSDVGVA ETSFRVGSSP ETSMSGGEHV DLSVNTEMVD ALTEPMWEWE QLNWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-33516717170NO APICAL MERISTEM PROTEIN
1ut4_B3e-33516717170NO APICAL MERISTEM PROTEIN
1ut7_A3e-33516717170NO APICAL MERISTEM PROTEIN
1ut7_B3e-33516717170NO APICAL MERISTEM PROTEIN
3swm_A3e-33516720173NAC domain-containing protein 19
3swm_B3e-33516720173NAC domain-containing protein 19
3swm_C3e-33516720173NAC domain-containing protein 19
3swm_D3e-33516720173NAC domain-containing protein 19
3swp_A3e-33516720173NAC domain-containing protein 19
3swp_B3e-33516720173NAC domain-containing protein 19
3swp_C3e-33516720173NAC domain-containing protein 19
3swp_D3e-33516720173NAC domain-containing protein 19
4dul_A3e-33516717170NAC domain-containing protein 19
4dul_B3e-33516717170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1758060.0AK175806.1 Arabidopsis thaliana mRNA for NAC-domain protein-like, complete cds, clone: RAFL22-40-G20.
GenBankAY0869440.0AY086944.1 Arabidopsis thaliana clone 29829 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126539.11e-171PREDICTED: NAC domain-containing protein 90
RefseqXP_013618994.11e-171PREDICTED: NAC domain-containing protein 90
RefseqXP_013723499.11e-171PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR31e-157NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A078F7X31e-171A0A078F7X3_BRANA; BnaA02g05600D protein
TrEMBLA0A0D3AKG11e-171A0A0D3AKG1_BRAOL; Uncharacterized protein
TrEMBLM4DUJ51e-171M4DUJ5_BRARP; Uncharacterized protein
STRINGBra020188.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-147NAC domain containing protein 90